DPCstruct | MC57523
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 77 ± 9 aa |
| Standard deviation of domain lengths | 8.88 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 94.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 45.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0108 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5ZQV5 | 11-79 | VAVFDTAFHQTMEATNYLYALPRELYEKHGIRRYGFHGTSHNYVSHRACEILGRDYNTKKIITCHIGNG |
| A0A3S4FYF4 | 62-133 | VFDTSFHQTLAPEAYLYGLPWEYFSSLGVRRYGFHGTSHRYVSRRAYELLDLDEKNSGLIVAHLGNGASICA |
| Q92JB8 | 11-75 | None |
| A0A2X3J4X5 | 70-144 | None |
| A0A177SYF0 | 1-89 | None |
| A0A177VS14 | 203-306 | None |
| A0A7G8CYM5 | 2-66 | None |
| A0A378AXI9 | 62-140 | None |
| A0A438N6D0 | 156-230 | None |
| A0A848A8L1 | 210-279 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.