DPCstruct | MC57519
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 215 ± 20 aa |
| Standard deviation of domain lengths | 19.56 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 93.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 41.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J4E445 | 2-212 | GCTLCQSFAPTHVCVITPQRYANCGAISWFDGRAAARVDPKGPIFKIEVGEVIDPVKGEYSGANEAVKKKSLGEIQRVWLYTAFGYP… |
| A0A7V2KMF2 | 2-198 | KMKEEEAKVFFAHTQCQRFAPNHVCIITPERPGCCGCLYQTYQEKINEGKDEYLSQFEKGECLDPARGEYSGVNNAVTARSNGKHSR… |
| A0A2H6JX87 | 177-397 | None |
| A0A7C0Y7L3 | 247-476 | None |
| A0A2D5URR8 | 415-621 | None |
| A0A7X7FKE1 | 1-195 | None |
| A0A520KWQ1 | 179-396 | None |
| A0A2G9XHP9 | 213-433 | None |
| A0A850LPY4 | 69-290 | None |
| A0A0U1KYA8 | 140-369 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.