DPCstruct | MC57515
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 210 ± 31 aa |
| Standard deviation of domain lengths | 31.15 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 21.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I8R0G0 | 24-278 | SRAEPSLAFDYLQRATNSERIRDNAFHDIVAYSPILAQSLPKSLVDLSLAYLIKELPDDRVARKREESRKHAEWRKATLAKPEEERT… |
| A0A377RW52 | 69-325 | NTLRNMLLRSARSYPEFARDLFKRTIVDERLRHHSYSDLIAFSPLMSVVAPELLADLARAELLQELPETRRQRERKRQEDYYERRAE… |
| A0A0N6ZTK4 | 423-616 | None |
| A0A414KLL4 | 323-513 | None |
| A0A415FFS4 | 188-378 | None |
| A0A6B3DVH3 | 708-906 | None |
| A0A2N5X6E0 | 51-344 | None |
| A0A0F3GJ60 | 365-556 | None |
| A7BRD4 | 6-206 | None |
| A0A6L6H8N6 | 217-418 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.