DPCstruct | MC57512
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 101 ± 20 aa |
| Standard deviation of domain lengths | 19.74 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 73.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 33.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00468 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6A1B0 | 26-132 | RFPGTTLLCRSKGAASSCSKLQSVSSLFSSWMGGEQRTLISKTKGREVFQSPPWHYQQVRTRKRGTEYQPNNIKRKRTHGWIKRIST… |
| A0A5B0SCQ6 | 1-72 | MICPTPQHQGILNPQSLNLLLGGIRFISRGNTYQPSQLKRKRRHGFLARMKTKTGRKIVFRRKAKGRKCLTH |
| A0A661UTT2 | 1-71 | None |
| A0A6U9Q3M3 | 91-168 | None |
| A0A1A6A5Z3 | 71-186 | None |
| T2M6K1 | 2-88 | None |
| A0A401KX94 | 78-207 | None |
| A0A0P7BE29 | 201-319 | None |
| A0A4U1EEZ3 | 1-73 | None |
| A0A0L6V4A5 | 45-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.