DPCstruct | MC57507
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 97 ± 8 aa |
| Standard deviation of domain lengths | 8.02 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 37.23 |
| Pfam Score | 91.67 |
| Assigned Pfam label(s) | PF09996- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7U1E9N4 | 1-82 | MTLNEPAELKARIDAALANGLIVRTRADADTMEARANDHARQTQAFASGAQYVSTDYLKPDVRFGPYEAHLPGGGTARLNPK |
| A0A3B8ZCT7 | 69-152 | FVSVPREHPAAAWMKLNDAVGSFDQISALVKAGFLVRTRADVGTVEARKNDTHRRDRAIASGAQLISTDYPEPDLRFSDYSLTL |
| A0A0D3LE65 | 627-723 | None |
| A0A5C8M376 | 4-92 | None |
| A0A0L0MYA6 | 275-383 | None |
| A0A3A0G2Z3 | 482-574 | None |
| A0A084QEV1 | 897-1003 | None |
| A0A812PTL0 | 267-367 | None |
| A0A062TVP7 | 202-295 | None |
| A0A0L0G2N4 | 104-208 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.