DPCstruct | MC57500
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 155 ± 29 aa |
| Standard deviation of domain lengths | 29.45 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 86.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 21.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5MPM1 | 1-174 | MAAGCAMAGSAIGAKLIYIGGEFLTDLRKPKPGSEKLCYIDDPYSVFGDLEREQAISLFNKMDYISAYRIFEELDKRVPGTKEYSAL… |
| A0A1J0LVE0 | 126-300 | LLERYPEDPVALDVTSGTKAMSAGLAAAGFFFRRFFPEVKVVYVDNEDYDVALRRPRAGSERLIVLPDPHEVGGEVDWLFASELYGK… |
| U7QMR8 | 53-194 | None |
| A0A0G1D9B4 | 106-239 | None |
| A0A150P0Y8 | 165-302 | None |
| A0A0C7NLY6 | 1-122 | None |
| A0A3D1IBQ5 | 137-325 | None |
| A0A3C1MAU6 | 85-287 | None |
| A0A832VXT3 | 107-221 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.