DPCstruct | MC5750
Metacluster Properties and Pfam Annotations
| Number of structural domains | 193 |
|---|---|
| Mean domain length (aa) | 112 ± 18 aa |
| Standard deviation of domain lengths | 17.50 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 86.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 16.68 |
| Pfam Score | 61.54 |
| Assigned Pfam label(s) | PF12957- PF19208- PF18441 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D0C3V2 | 7-72 | DKKPTLEEAQALVGGFVEMVRSPNNSEIQILVNEEGLLKGLPFNEEATKICGTGIVGNAVILKGNA |
| R9M588 | 3-102 | NKIDILVVEPGEAPRPAKVEDTLEAFQQIVGGPIEAGCYLPQRVMLICNSEGKNMKLMPNRENPTDNGDFIAGTFLLCGFEGEHFTS… |
| A0A1G6HLN7 | 1-114 | None |
| A0A7X7NQH4 | 1-105 | None |
| A0A1M6M8Y7 | 114-215 | None |
| A0A2I0EZ12 | 153-258 | None |
| A0A6I3PU99 | 1-123 | None |
| A0A7G9GEZ8 | 1-92 | None |
| A0A1G6HM36 | 1-107 | None |
| A0A0D6JB46 | 1-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.