DPCstruct | MC57499
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 116 ± 16 aa |
| Standard deviation of domain lengths | 15.64 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 92.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 33.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B9JI07 | 13-117 | EDHLKRLSDLLERDKTHIEDKERIALFYILSGKDSLYQNIDKIYDFENHTIKPECLNDGEWTSEDRKLIALAFNLYNNYEITPLEVF… |
| A0A1V5MP49 | 2-131 | NNMLKFKNKEHLEFFNNCLAYPGIPNDSYYKALFYTLGLTNETRKNINSLFDFERRTIDFNGFKKGWQTGTSKKVTRLAFNLFNGSV… |
| A0A843H1T6 | 2-129 | None |
| N2AAX7 | 2-106 | None |
| A0A417BBV0 | 14-152 | None |
| A0A415WZA8 | 2-106 | None |
| A0A1I1RQL6 | 168-292 | None |
| A0A645GY17 | 2-88 | None |
| A0A416DMY7 | 6-88 | None |
| A6TV41 | 2-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.