DPCstruct | MC57497
Metacluster Properties and Pfam Annotations
| Number of structural domains | 74 |
|---|---|
| Mean domain length (aa) | 293 ± 45 aa |
| Standard deviation of domain lengths | 44.82 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 76.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.32 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 19.46 |
| Pfam Score | 93.83 |
| Assigned Pfam label(s) | CL0125- PF13559 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5LZY1 | 388-680 | AVSITKNEQGNFDKVKAIEQYLSKNYKYTYTPGTPPENTDFVDYFLFENKEGYCTYFASAMSILTRCIGIPSRYTEGYVLPSQPVKD… |
| A0A7Y8NQS2 | 18-349 | MAQNSNRSVDKIMLQIPESLTYSTKDIARYINSQFSTQNEKARAIFIWIARNIRYDMANMNVATSELNLVETNFKTLKTRKGVCTNY… |
| A0A6G8FUR2 | 842-1160 | None |
| A0A7V3H4I7 | 183-506 | None |
| A0A354W509 | 1-190 | None |
| A0A537ZHK0 | 2-184 | None |
| A0A417VV85 | 134-506 | None |
| A0A7C5D6V1 | 13-289 | None |
| A0A842XTA5 | 53-340 | None |
| A0A7T9EBV4 | 372-610 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.