DPCstruct | MC57496
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 166 ± 25 aa |
| Standard deviation of domain lengths | 24.96 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 17.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5LZN0 | 1-182 | MDGEKPIELSTKEITLYEEKLLEYFKNVENSKPTIWETLKSIILGSVIVFSTVSIELSDTDRNFKPLKIFLDSNYIFSLLELDSDEI… |
| W7YU78 | 4-135 | KIYFGSVIAGFLESGIDVNAKFLSGEEYFIDTQIILRGLDLQNESDTQPAKELIDLIIKLQGKPKYLGITLSELSHILEVSIENYNK… |
| A0A3M3GUE5 | 55-235 | None |
| A0A1F2V859 | 167-322 | None |
| A0A0N0IG21 | 7-228 | None |
| A1BIL7 | 156-322 | None |
| A0A1Q8AYE3 | 7-149 | None |
| T1BQK4 | 2-156 | None |
| A0A450YLL3 | 1-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.