DPCstruct | MC57494
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 95 ± 13 aa |
| Standard deviation of domain lengths | 13.18 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 32.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A819XCZ7 | 1-72 | YDRKRVQEIGPDRACAEWLLRCGGLVRFKNWGTFTSNYNALPIGAPGQFKIEEIRAVNACITPEGFAYLDGL |
| A0A194AKW7 | 15-115 | VLRRTTPSLFQPAGTCRHLMKYLNFIPNAPDPSRTSKVGPDAACAEWILKLGGAVRFEGDKEWIRNYNFLPSVMNPDYKPGLVLDEI… |
| A0A2Y9MV94 | 9-105 | None |
| A0A4C1Z8H3 | 226-318 | None |
| A0A3P7D057 | 55-153 | None |
| A0A368FMA5 | 24-120 | None |
| A0A7E4VU30 | 224-307 | None |
| A0A2K5Q991 | 2-87 | None |
| A0A1I7WUS9 | 395-492 | None |
| A0A7J8CFH8 | 1-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.