DPCstruct | MC57492
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 370 ± 47 aa |
| Standard deviation of domain lengths | 47.03 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 17.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N3FHS8 | 655-1065 | YVYEYTGSCPFLFTWDGEKFDYEADLYTTGKLASQRASGTYQKPNPHDYYVLDNTPVEKDGALELRLVEERFETDYLDEFTLYAVDV… |
| A0A3B0VCT2 | 2-318 | QIQVLDVPKQWSVVLDERMMISAPQVTGEPLFYQSIINPVQVLDKYNQDVTELVLRTDKQAIEINNKDTRFLGLVDEQVITMEFADE… |
| A0A7Y2B020 | 417-841 | None |
| A0A660VMJ4 | 681-1076 | None |
| A0A2N3FH07 | 233-635 | None |
| A0A5C6AT36 | 831-1247 | None |
| A0A2N5ZPS6 | 739-1092 | None |
| A0A424Y4W6 | 45-413 | None |
| A0A0G0B9R1 | 187-539 | None |
| A0A7W2AUJ8 | 10-381 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.