DPCstruct | MC5748
Metacluster Properties and Pfam Annotations
| Number of structural domains | 150 |
|---|---|
| Mean domain length (aa) | 173 ± 27 aa |
| Standard deviation of domain lengths | 26.50 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 12.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20201 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A401UCI8 | 56-215 | ATVYKKGVYKTFEEFKYNDPSIVEDFTFDKNQLWLTDSKTGKNSKIKKNEVWGFSDGARIFVRWRKYNEIVEMGRYCYFKEKGTRVV… |
| A0A1M5U4Z2 | 12-189 | INILANAQHEQGIIYTKDGNIIKVEIPIYKQGTIITKSKIKYLKGDKKKKISLSKIDHIEIDKKNYKVITYKKEEKFGPNRGIKTHT… |
| A0A5B2UDY8 | 72-254 | None |
| A0A562KHP2 | 4-178 | None |
| A0A0Q5UK48 | 42-190 | None |
| A0A519N250 | 96-262 | None |
| A0A1M6SZ75 | 27-215 | None |
| A0A0J6CN58 | 2-164 | None |
| A0A7Y7NVB6 | 20-226 | None |
| A0A1H4AZI2 | 32-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.