DPCstruct | MC57479
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 216 ± 15 aa |
| Standard deviation of domain lengths | 14.53 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 14.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A847G7U8 | 95-304 | STTIAGENVSYLYIFTGRFTREQDFLQVIDLDYIDSEETFETDGRVIPDWGEGDIPVVMDWEPIAYVVDDGSRKQMVLLEPNTFGAG… |
| A0A3M0WS10 | 193-403 | SEDVNGTNLGYIYLFVGYLDENSNSIFLADSDYLESADTREVDGIYYPIWPEGETFTLEFEWEPVVFAITDGQNDVVARFQPQSYGA… |
| A0A660VPM1 | 589-798 | None |
| A0A521H411 | 515-743 | None |
| D4J0B1 | 149-354 | None |
| R5LJ60 | 640-862 | None |
| A0A662ZBF1 | 505-720 | None |
| A0A7K4B8H1 | 5-189 | None |
| A0A851IH30 | 25-247 | None |
| A0A7V5ARD3 | 159-351 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.