DPCstruct | MC57478
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 146 ± 21 aa |
| Standard deviation of domain lengths | 20.60 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 26.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A847G227 | 9-149 | KAPLWLLLIASEGIDLLFFLFSFIGLEKQAVSRSSIERGIEVITPGILYWSQGLFMAIIWSIAAFLLTYFFLKEQRAALIVGLVFFS… |
| A0A538TEF5 | 11-158 | AAKSGDRSIPLWVLFIAVQLLDVAWAPFVLLGIEKVRIVPGFTATNPLDLYYMPYTHSLVAALLWSAAAFAVYRLVAPGKRAWSALL… |
| A0A536YDI6 | 1-159 | None |
| V9D448 | 5-146 | None |
| A0A2V6GDD2 | 18-160 | None |
| A0A077WF35 | 1-171 | None |
| A0A2V7WIE3 | 1-127 | None |
| A0A0C1IKH6 | 1-152 | None |
| A0A7W1EPJ8 | 1-179 | None |
| A0A2V6MHY0 | 1-192 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.