DPCstruct | MC57470
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 85 ± 10 aa |
| Standard deviation of domain lengths | 9.93 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 78.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 36.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D0KQJ9 | 2-85 | NYLQPKDLAALQRFKETSDDGEGYDVSREQMHRLAELGVVCYHSMGIYSITWFGMYVLNPSDKALQPPFKTESDHFCEFLEEKS |
| A0A2G0YV45 | 1-69 | MTITAQQERDILRFRDTCEDGQGYDVPKDRMKSLARLGLIRPTGFSRYEITDVGDAAIEVLLTALRIKP |
| A0A7V8F4R2 | 129-214 | None |
| A0A6B2FR42 | 10-98 | None |
| A0A509JFI2 | 11-99 | None |
| A0A376HY75 | 86-179 | None |
| A0A842HJW6 | 86-171 | None |
| A4JU74 | 129-208 | None |
| A0A5A7MKM7 | 2-73 | None |
| A0A1I1CFW4 | 597-690 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.