DPCstruct | MC5747
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 122 ± 7 aa |
| Standard deviation of domain lengths | 6.93 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 81.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 61.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16088 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S4ADI6 | 1-129 | MATSTSTGKTGGSSSSRDGSAKTMVADQITQSIQSTSNLLHLMLQSSPSQAELMKLPKTLFAKTPTIKNTELVLEQLPQVISALDAH… |
| A0A6I9TDR3 | 5-120 | SGGGRRKESAKAIVADQISQSVQSTSNLLHLMLQSSPSHAQLMKLPRNLLAKTSTIKNTEMVLEQLPQVISSLDAHTERGLQSVPHL… |
| A0A835IYS1 | 7-140 | None |
| A0A6P6TXE2 | 54-170 | None |
| A0A314YF66 | 2-122 | None |
| I3SK68 | 1-129 | None |
| V4VCD3 | 1-124 | None |
| J3LBR3 | 1-117 | None |
| A0A4D6NCA1 | 2-121 | None |
| A0A6P5ELF0 | 50-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.