DPCstruct | MC57451
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 85 ± 10 aa |
| Standard deviation of domain lengths | 10.40 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 23.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A545Z0I2 | 1-76 | MPRYFFDLHRVDSELFDDEGTEFGKPDDAVIEAEVAILEFFVESFKMSKEFDLVGIRICDAAGVLVREVSSRDILA |
| A0A4P6FPH6 | 3-88 | DRAFFVGTGREQLMPRFFFDVVSDKRDDDVGGLNLPDLASARREAARSAEILAREDLAQGILASERHIEIRDETGLMVEVVTIPQP |
| A0A0H1R6U9 | 2-80 | None |
| A0A0Q8S384 | 68-146 | None |
| A0A1B3MI12 | 1-81 | None |
| A0A512C1C8 | 22-96 | None |
| A0A6N6MZR1 | 1-81 | None |
| A0A4Q7G6F0 | 1-75 | None |
| A0A7W7A6Y5 | 1-93 | None |
| A0A370HG69 | 1-69 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.