DPCstruct | MC5745
Metacluster Properties and Pfam Annotations
| Number of structural domains | 62 |
|---|---|
| Mean domain length (aa) | 534 ± 101 aa |
| Standard deviation of domain lengths | 101.19 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 70.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 20.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L9T1Z9 | 83-574 | EKDRRPLSKFRILNGLNAGRIADEAACGSQTLAGTSITLTMSDGCVEVLTGEEFIRGKYGERGMAFVANIISALDCDNGRYEDDDLA… |
| A0A5N7BBC2 | 3-570 | MPTLTRSTNMVKILSCSEYLTENYGSLGIYVLESIIEALAHGEKGYTTDNGCLKIKAGPYEVTVNSTRSAVKVREIMIWICLTFRKT… |
| A0A317XDV2 | 17-627 | None |
| A0A0A1TP50 | 306-878 | None |
| X0ADL5 | 301-1018 | None |
| A0A2J6TBM6 | 27-558 | None |
| A0A178AHA9 | 4-404 | None |
| Q2H4N9 | 1-355 | None |
| A0A0D2HX85 | 469-1124 | None |
| A0A366SAL9 | 181-822 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.