DPCstruct | MC5744
Metacluster Properties and Pfam Annotations
| Number of structural domains | 77 |
|---|---|
| Mean domain length (aa) | 231 ± 33 aa |
| Standard deviation of domain lengths | 32.82 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 26.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0268 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N7B8K0 | 3-241 | DTTQQGIYMENGSGWLLSDLTFVGGNFSTYFGNQQFTTSHLVFVNCSSALQTHWDWAWTMQDIIIESCNTVIIIVGDASGPMSDGQP… |
| M5C3F6 | 11-223 | ITVANAQSGIFQPWNWGWTFQDVKIINCQVGFDLTTGGLTQDQQTVGADVIVDAVVTNTPTFIRTSGSAPSSLAGSLLLDNVKFTGV… |
| H1W577 | 104-323 | None |
| T0LMM2 | 62-262 | None |
| U7Q190 | 386-613 | None |
| U7PQ26 | 737-998 | None |
| J3PE45 | 203-468 | None |
| A0A0A1TDH2 | 1-152 | None |
| A0A0B8N397 | 236-469 | None |
| A0A5N5PDK6 | 178-438 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.