DPCstruct | MC57431
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 106 ± 18 aa |
| Standard deviation of domain lengths | 18.29 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 89.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 31.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14101 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A023DJX2 | 11-104 | KQSIYFDQFLWHIFSYEKLPCLEGKEAMRAFREMNRVICYLFYQEREETYMLINAENLRAEGLRNEHDVCVVDPHFMWTYVQTHEDY… |
| V2Y533 | 3-118 | FEKEWLLHFANNISKSLLKKRVVGGGNFLWHIFSWNIVDADKYFTRDNARKIFDELDKSGAKYFDLWETNPSLKLLEKEMDSKYIDK… |
| A0A645IHY0 | 1-75 | None |
| A0A518HT94 | 13-131 | None |
| A0A371JBY8 | 68-180 | None |
| A0A449BC64 | 6-120 | None |
| A0A2G5X4N3 | 5-116 | None |
| A0A416Q7E8 | 91-213 | None |
| A0A178TT97 | 94-215 | None |
| A0A2T6DIN9 | 26-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.