DPCstruct | MC57426
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 107 ± 15 aa |
| Standard deviation of domain lengths | 14.57 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 72.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 33.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I6B2X5 | 3-128 | RPSVEDRAAMFIEKARPSISGQGGNAALYSVAAGLVIGFGLDDAKALSLLRKYNSISAQPPWPENELERTIRNARKAAERDPGAVGE… |
| A0A2V6CE30 | 4-89 | NPITLRERIERFVDSCPSAISGQNGHDQTFRMACILVQGFDLSPADAFSFLARYNQRCEPPWTEKELRYKLADADRAQSNKERGYL |
| A0A037UQU4 | 7-112 | None |
| A0A2A2R0V3 | 5-106 | None |
| A0A842HIQ0 | 3-105 | None |
| A0A0E3YWV0 | 33-145 | None |
| A0A7V8V9F8 | 198-308 | None |
| L0DBJ0 | 277-362 | None |
| Q2IHW0 | 13-92 | None |
| A0A7W1IIL1 | 101-207 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.