DPCstruct | MC57423
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 127 ± 13 aa |
| Standard deviation of domain lengths | 13.36 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 32.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N2PC73 | 119-226 | PRTMETVLHHAELAGIDLQDVDVEIVEDTDTLRYFDFMGACARTDDLGIQLGPAAFVDAETLVRTLGHESIHVQQWRDNRVNSNVVA… |
| A0A285KNJ1 | 217-344 | KGLFREGDGIARNGKKILMSRDNVLALAEKYGIDMEDVALTIDKFRRGGGPGKEFYGVTMPDGEIKLARDAFMDEEQLARTLAHERF… |
| A0A1C6CWY1 | 218-351 | None |
| A0A220MKJ9 | 297-416 | None |
| A0A4R2IS65 | 278-393 | None |
| A0A7X8X7I3 | 1-130 | None |
| A0A4R6JQQ1 | 1-147 | None |
| A0A1V2AVZ9 | 856-999 | None |
| R6NX66 | 179-313 | None |
| C0WCA5 | 167-272 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.