DPCstruct | MC5742
Metacluster Properties and Pfam Annotations
| Number of structural domains | 167 |
|---|---|
| Mean domain length (aa) | 169 ± 27 aa |
| Standard deviation of domain lengths | 26.50 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 75.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 19.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12013 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N7APP4 | 5-185 | IFQKLDGLPVIIYKAYQHGVWPNEIVRHLKGSAHAKPHEEAVQIQETIQRWENVAMGPEGIIIPHQINQAWPELPIYPNGLMCRRDS… |
| A0A0C3FCI9 | 42-198 | LDGSHCYLITCELLDRLGFASHKALRVLICRKCRYSFIPNEVIGHAHSCQNVSPRSIDLEEFQELVLGQLIHLEVSSVLHPSPWGPP… |
| W9NF51 | 25-166 | None |
| A0A4Q7KA64 | 239-387 | None |
| W9NSF5 | 185-392 | None |
| A0A2V1BLX7 | 8-192 | None |
| A0A1B8A9A2 | 2-129 | None |
| A0A6A4GBZ9 | 200-371 | None |
| A0A0J9W1K7 | 15-217 | None |
| W9N989 | 23-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.