DPCstruct | MC57416
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 82 ± 6 aa |
| Standard deviation of domain lengths | 5.93 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 45.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0493 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A657IVM2 | 1-91 | MLAAAPFAFLPILVGFSAAKRFGGNPYLGAAMGMAMVMPQLVNGYDVAQALAENRMTYWDVFGLQVQQSGYQGTVLPILVVAFILAN… |
| A0A378AXV4 | 3-87 | IGEAIFFYLPVGICWSAVKKMGGTPILGIVLGVTLVSPQLMNAYLLGQQVPEVWNFGLFTIAKVGYQAQVIPALLAGLALGFIET |
| W4QD69 | 24-103 | None |
| A0A2V2L0V4 | 1-81 | None |
| B9DLG6 | 161-228 | None |
| A0A845EJE3 | 336-423 | None |
| A0A4P8CA10 | 162-239 | None |
| A0A5C8XA62 | 95-174 | None |
| A0A0B0HIC5 | 35-118 | None |
| A0A0B8Q1D3 | 7-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.