DPCstruct | MC57413
Metacluster Properties and Pfam Annotations
| Number of structural domains | 171 |
|---|---|
| Mean domain length (aa) | 242 ± 42 aa |
| Standard deviation of domain lengths | 41.58 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 83.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 15.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14284 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y8F1W0 | 35-303 | RRQAIFAAISTREIKAGVADVGSELFSPTFAEVVRYGRAMDILRHAYGDIPAGLPGMLERVGEKPLPRAKDYIAIYDLLISDDARGA… |
| A0A1Q3MJR7 | 132-389 | WFIIVAQGGSLAKEMKGQLTKKEVHWFLQAPDENSITRNLFWAKCAAAGVPPKLCQFLTIRMANPKLLEALGDRLPDVIRFYATEHK… |
| A0A7X9MGD6 | 237-467 | None |
| A0A0K2RAE7 | 69-272 | None |
| A0A316KJ40 | 47-316 | None |
| A0A519P922 | 90-316 | None |
| F1VYL1 | 243-504 | None |
| A0A416PDK3 | 392-604 | None |
| A0A2W1U7R4 | 351-614 | None |
| A0A2N0AXK1 | 478-736 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.