DPCstruct | MC57412
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 115 ± 20 aa |
| Standard deviation of domain lengths | 20.44 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 82.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 23.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q3MJE0 | 21-111 | DAQAVEILTSGHYDLGVAYEDGGLEPHIHGHTGGGNEYAPDEAYFWAKDNHLFTRPAGSQWNFIGVSSGEQYYKLPTTNQVGKIYLG… |
| A0A1I2AQ07 | 8-91 | TVISDGHIDMGPRLDHGRWIIGIRDDSGPSPVWRDPDDTVLQAVDAAAVTVPADKRFSFLGRAGNQVWLLPQVQQQGVLWPGWN |
| A0A6B1M470 | 1-100 | None |
| E4HHC3 | 98-212 | None |
| E4HHC2 | 28-138 | None |
| W4TSL0 | 1-92 | None |
| W4TRG8 | 51-166 | None |
| A0A0F0KSY0 | 19-145 | None |
| A0A1Y0H1B1 | 1-78 | None |
| A0A0P0DGP1 | 2-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.