DPCstruct | MC5741
Metacluster Properties and Pfam Annotations
| Number of structural domains | 146 |
|---|---|
| Mean domain length (aa) | 187 ± 42 aa |
| Standard deviation of domain lengths | 42.07 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 74.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 25.34 |
| Pfam Score | 98.65 |
| Assigned Pfam label(s) | CL0061- PF11905- CL0016- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W9WUE2 | 3-102 | IACSVVVPSKSSTVGPEIPESLRPTALQLTTIHPTWIDRFPFPKMRDNMITLMGIINEEEFLADLFCLTSFTLNPGAASWDPTAWKI… |
| A0A5N7AP65 | 41-221 | TSSTHSIAHSVGNPMPTIRVGFFTASIVNCRLLGLDPHTALNHDAISTFMRSEQNITGQNYDHYLDDFKNAAQPLSQNLNNDMRSTL… |
| A0A4Z0YHT7 | 30-245 | None |
| A0A3N4JWB4 | 3-141 | None |
| A0A1V6P0Z7 | 54-269 | None |
| H0EDI6 | 3-118 | None |
| G3JDW0 | 129-343 | None |
| A0A6G1IJN3 | 2-124 | None |
| A0A395H713 | 41-232 | None |
| A0A162JJH9 | 24-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.