DPCstruct | MC57409
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 550 ± 51 aa |
| Standard deviation of domain lengths | 51.37 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 25.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R5Z5X7 | 324-839 | TEKMKQNVYDFTKDTIKKFQEVGADIGMVQVGNEITNGMLDIMPDRSKGETYKDTWGNAKNAKILCGYLKAGIKAVRECTPKALVTL… |
| F2JNT0 | 479-1004 | ENYSLEEKKSAMYEYTKESLQALLAAGVDVGMIQVGNETTSGFCGENDWANMCALFNEGSRAIREIDPNILVALHFTNPETSGRYAS… |
| A0A1F5JX68 | 150-765 | None |
| E6LHW7 | 1-608 | None |
| A0A3C1WUB9 | 325-859 | None |
| A0A3B9D4I9 | 214-822 | None |
| A0A0C5CBZ6 | 595-1114 | None |
| A0A366SFC7 | 152-617 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.