DPCstruct | MC57408
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 234 ± 36 aa |
| Standard deviation of domain lengths | 36.44 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 79.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 19.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18960 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A413PFW3 | 16-233 | DTNSNHALNYEVEYIIGGRASDKDNLKIVIAEIMALRTAANMAYLSGSASKQAQALALATIIGGITLQPEVIEGVEKGILAAWAFCE… |
| A0A3R6IWS9 | 95-332 | EGAGAAQGNEDALIQKQWFIGYACEYLTQASDHLAEGREDGYLDYQMEYLFAGQPSDQRNLELTILSLLALREGANYTFLMTHSNYK… |
| A0A7X8W6C3 | 493-713 | None |
| W2BZD7 | 60-382 | None |
| H3NPV5 | 762-1070 | None |
| S0FZI3 | 302-553 | None |
| E6LKH4 | 369-579 | None |
| A0A3A6JZ01 | 195-441 | None |
| A0A350VYQ2 | 14-247 | None |
| A0A7X6U7L5 | 1-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.