DPCstruct | MC57405
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 284 ± 52 aa |
| Standard deviation of domain lengths | 51.94 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 82.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 20.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A222P4W3 | 322-616 | GNTCPLGNLPFEIMEHINNYAIGGSYPDIFFKNFASPTKADAVNKFLHHVVRGEHEVVCEMLKQDISILVKKGSVIDCSGRSFEHIS… |
| A0A0W0Z1Z8 | 5-155 | HIKRIQLPKFLEHTARGEQNDAENLLKANLDAQFLLASESFTDYSGRTFHCTAFEYAYWAKDIHMCRMLKSYMDEATKTEMLRRCED… |
| A0A0W1AJK6 | 14-300 | None |
| A0A1G0HEX1 | 25-376 | None |
| K1ZGN6 | 135-465 | None |
| A0A516MZY0 | 42-336 | None |
| A0A6F8T5L0 | 9-267 | None |
| A0A521Y5N0 | 19-314 | None |
| A0A1G0YPK0 | 1-231 | None |
| A0A5E4PD14 | 106-382 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.