DPCstruct | MC57403
Metacluster Properties and Pfam Annotations
| Number of structural domains | 814 |
|---|---|
| Mean domain length (aa) | 86 ± 14 aa |
| Standard deviation of domain lengths | 13.80 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 77.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 18.91 |
| Pfam Score | 97.38 |
| Assigned Pfam label(s) | CL0125- PF04043- CL0221- CL0704- PF14309 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N5JZY7 | 5-90 | VAVAGEKKAEMKVDGMTCNGCVSKVKSSLEKVDGVKSVEVSLENSMAVVVFDDTKTNESTLKNAVNQSGYKAADVKAADGKKAGCC |
| H1HWP1 | 1-70 | MKKKFACEIDCANCAQKVEDAIRKVDGVVDVKVNFLMQKFTLEAEDASFEQVLDAAIRAGQRVEADFTVV |
| A0A7S4E7Y0 | 199-267 | None |
| A0A453DBR5 | 57-162 | None |
| A0A1R3KD52 | 30-130 | None |
| A0A2C9VYQ9 | 10-97 | None |
| F4PJD4 | 81-150 | None |
| A0A7C7QMQ9 | 44-121 | None |
| A0A2V6J694 | 13-103 | None |
| A0A7Y3JHI8 | 222-305 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.