DPCstruct | MC57400
Metacluster Properties and Pfam Annotations
| Number of structural domains | 493 |
|---|---|
| Mean domain length (aa) | 165 ± 31 aa |
| Standard deviation of domain lengths | 30.59 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 77.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 19.00 |
| Pfam Score | 91.46 |
| Assigned Pfam label(s) | PF19264- PF12789- PF07484- PF03906 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G9RT16 | 9-152 | VMPVGCVIPFAGAAAPTGWLLCQGQAVSRTTYAQLFSVIGTTYGSGDGSTTFNLPDMRGRVAVGSDANSPGAQCGETAHKLGISEIP… |
| A0A271QJE5 | 87-202 | PAEFYPVGAPIPWPSDTVPSGYALMQGQTFDKSAYPKLAVAYPSGVIPDMRGWTIKGKPASGRAVLSQEQDGIKSHTHSASASSTDL… |
| A0A285CJ35 | 5-156 | None |
| A0A238UCI8 | 225-421 | None |
| W6WFI8 | 21-213 | None |
| A0A0F9UC68 | 573-756 | None |
| A0A7X2UP57 | 97-233 | None |
| D4CXR4 | 147-338 | None |
| A0A0Q2UK27 | 18-164 | None |
| A0A484X955 | 328-435 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.