DPCstruct | MC5740
Metacluster Properties and Pfam Annotations
| Number of structural domains | 70 |
|---|---|
| Mean domain length (aa) | 131 ± 19 aa |
| Standard deviation of domain lengths | 19.00 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 77.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 20.96 |
| Pfam Score | 57.22 |
| Assigned Pfam label(s) | PF15474- PF09044 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A146I6Q5 | 218-314 | GINCKGSSLCSVLPASDCSAAAAQIVNTTVYRTDETAAQTGVCSGHCGIFVQGTDCYYDGSSLVEAYAALRSKNCKVCGSQEYLNGC… |
| A0A5N7AMR9 | 1-130 | MAPQWATLALTNVFEPDPSNYNCKGLSICTTPNFLKWCNHAVNSLQRNDVPSYFPTSANETGINQSGNCWGDQTRGCGVFIQGDASC… |
| A0A5C3L526 | 3-113 | None |
| A0A5B1QMX6 | 4-125 | None |
| A0A124GTD4 | 604-718 | None |
| A0A0L1JIB8 | 299-429 | None |
| A9TRD9 | 6-108 | None |
| A0A179IIE1 | 720-862 | None |
| A0A2V1DMK1 | 1-148 | None |
| A0A2H2YV30 | 1-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.