DPCstruct | MC574
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 186 ± 31 aa |
| Standard deviation of domain lengths | 31.30 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 77.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 27.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A819I310 | 172-379 | KVVNGQNQKENDNELLPMNSIQRFKPSYLKISDQGFKQMLSNGIDNGDEIIQCLNTDEKLQCVRQMTEKTNTIYYLDLQRQLWRDYY… |
| A0A821FUL3 | 2-154 | FIRQLTQLVNKLNYSQLQNEQWSYYYNLGMTEGIWNGRVSKKMADANAMCYTYGRSKILIKQRLDKYKLQCEQVQHAINEHMKQAPI… |
| A0A820A7F4 | 396-697 | None |
| A0A820H511 | 7-203 | None |
| A0A822CYN9 | 2-164 | None |
| A0A819R2C5 | 405-591 | None |
| A0A819PTC8 | 2-162 | None |
| A0A819MZF8 | 61-244 | None |
| A0A820D9B8 | 323-517 | None |
| A0A815P8R6 | 9-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.