DPCstruct | MC57398
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 103 ± 7 aa |
| Standard deviation of domain lengths | 6.62 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 43.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0029 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E5Y1C7 | 41-136 | SEFMGLIQGVYDAKAEGFVPGGASLHNCMSGHGPDAETFEKASNGDTSKPHKVDATMAFMFETPAVIRPTRFAAESAQLQAKYFECW… |
| A0A4U0SLL8 | 122-216 | PQHVMGLVEGAYDARAEDFVPGGASLHNMMSAHGPDRMTFDTASSADLIPQKVDDGLAFMFETRWPVVPTAYALAAEHQRPGYDEVW… |
| A0A6A5L4N8 | 584-688 | None |
| A0A061M5Q2 | 740-836 | None |
| A0A0B4H1J6 | 1-101 | None |
| A0A4S8J089 | 343-447 | None |
| A0A830HQW7 | 460-564 | None |
| A0A367KQZ0 | 613-713 | None |
| A0A835S3R6 | 359-458 | None |
| A0A2I0TCT4 | 303-400 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.