DPCstruct | MC57397
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 185 ± 30 aa |
| Standard deviation of domain lengths | 29.71 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 92.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 32.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0525- PF21167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V5ZXT2 | 3-151 | QPPGGSGPGVWIPTPPAFLPYLLPQWGFVAPFGMSSPSQFRPPGPPALESQQYAADYEEVKELGALVGSTRTEDQTEIALFWADGAG… |
| D8THX8 | 95-290 | VPMIKEIINKRLCDGSSFFANFKPASDTASPGVFRLAPGQVAVHYPQVANANGFYLSSKEVDAFTARLTHFTLTDPEYAAQLEQTYW… |
| L1KK96 | 36-171 | None |
| A0A841VVU8 | 323-563 | None |
| F0ZL98 | 193-349 | None |
| A0A1I4EBI2 | 455-650 | None |
| F5UMX3 | 293-491 | None |
| A0A3D8LDP4 | 278-480 | None |
| A0A1Z4IQW3 | 253-451 | None |
| A0A353B734 | 294-462 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.