DPCstruct | MC57396
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 114 ± 15 aa |
| Standard deviation of domain lengths | 14.96 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 90.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 21.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04738 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U0SHC7 | 1-119 | MEHIPRIRCGRVVLQRETWRVPAARLRGAAVFGGSVGQTGGEEAAEFVAVCRLRSELGLPRHVFVKVPGEPKPIYVDWQAPLLVRQL… |
| A0A7V9FKT4 | 304-409 | RAQIGRLVVRRACWSTPAGVLPAKPDELAAWARDRGLPRHVFARSPLERKPRYVDFESPSLRRQLVRFLARAREQVPDRPVEFTEML… |
| A0A066ZB01 | 93-241 | None |
| A0A1V2IMH8 | 292-385 | None |
| A0A833JBE1 | 147-274 | None |
| A0A355F820 | 162-289 | None |
| A0A223RTI8 | 83-203 | None |
| A0A564RW70 | 265-371 | None |
| A0A7T9DCD2 | 413-525 | None |
| A0A220MCM0 | 484-603 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.