DPCstruct | MC57393
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 310 ± 37 aa |
| Standard deviation of domain lengths | 36.71 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 76.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 15.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M2CQY6 | 2-326 | ALAAAALTLLGLLGPRVRCPPHCARCRFDLSGHDVDRSLIPITCPECSLLIATPYQVRRTRREPHRTRLTAGLTLAGFTLVTAVTML… |
| A0A7Z9Q132 | 25-331 | MEGMFTFAWYSLMFGAALAVCGRFARQPGQISCMKCDYPLVGLQLPCPCPECGTMISYLSDATDRPRARDTRLVLIGIAIAVLSLAM… |
| A0A7D8UHS6 | 5-366 | None |
| A0A7T9EIF6 | 13-382 | None |
| A0A3M2C912 | 91-443 | None |
| A0A2D9CA06 | 3-323 | None |
| A0A7T4YCT1 | 14-344 | None |
| A0A3D1F4Q8 | 2-287 | None |
| A0A2E8JYK8 | 35-362 | None |
| A0A2E2B487 | 9-303 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.