DPCstruct | MC5739
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 83 ± 7 aa |
| Standard deviation of domain lengths | 6.82 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 48.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02547 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X1NH99 | 1-94 | MTLHVGAGTFQPVRVDTIEDHIMHSEYAEVPQDVVDAVLAAKARGNRVIAVGTTSVRSLESAAQAAKNDLIEPFFDDTQIFIYPGFQ… |
| A0A447JI75 | 3-82 | SNRKIQTKCVEEVTINEEYYEVPQATADIINTAKQNGGRIFAVGTTVTRCLESAYSREHNCLKVSSGWTALYIHPGYQLK |
| A0A525VXQ4 | 118-202 | None |
| A0A379VRM8 | 14-88 | None |
| A0A379V3Y5 | 120-207 | None |
| A0A6I1IXL7 | 88-172 | None |
| A0A3R6MXW2 | 203-288 | None |
| A0A812NKX3 | 204-289 | None |
| A0A850QRJ9 | 48-136 | None |
| A0A243V812 | 1-74 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.