DPCstruct | MC57387
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 104 ± 15 aa |
| Standard deviation of domain lengths | 15.28 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 22.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W7T9L6 | 3-120 | SSNDALRALNDHGFQYVIGPGYTSNGKEIPFTLLYVRAWGEAPFIDLVHLRAEDDATALRVASNGPNPNLFARDNIVWSSRDGGDLV… |
| A0A1H0X0L7 | 2-110 | EVGNLLTAITRDGFTWRFCNGPHRPTALVATYEWDDVIDLALIRDRDDVITARLPITHNTDIFAPETILWVYVGEAHQALQALLDLP… |
| A0A7W7C8C3 | 2-78 | None |
| A0A7W7FTH8 | 9-112 | None |
| A0A4R2PUQ9 | 1-78 | None |
| A0A419I937 | 8-84 | None |
| A0A4Q7KMV8 | 40-167 | None |
| A0A347PT27 | 2-81 | None |
| A0A347Q8I7 | 3-107 | None |
| A0A1I5GP25 | 37-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.