DPCstruct | MC57383
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 84 ± 8 aa |
| Standard deviation of domain lengths | 7.53 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 60.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A445MHW6 | 1-84 | MDDELLQAVKDLESARAELPRQSVAQYKESLSFKEGLKRMGRVAYEYGYRVALARFRTRHPNADVEEDPFTIHPEDDLVPMERQ |
| A0A427AEB8 | 1-74 | METELLELARSKDALQEDLPRRAIEDYKKSLGFEMGLVRMGRVSLEYGYQLALARLQARHPGVEIELDPFVSLP |
| A0A427B5X3 | 1-79 | None |
| A0A426ZFG9 | 1-81 | None |
| A0A4S8IZE4 | 1-102 | None |
| A0A426Z9I1 | 1-84 | None |
| A0A444CF81 | 153-236 | None |
| A0A426XL57 | 196-290 | None |
| A0A444BW97 | 1-84 | None |
| A0A426X6D6 | 1-68 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.