DPCstruct | MC57382
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 126 ± 15 aa |
| Standard deviation of domain lengths | 15.29 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 36.07 |
| Pfam Score | 96.15 |
| Assigned Pfam label(s) | PF09997- PF05981 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A640VYE4 | 16-135 | AFCFMAQAAAAERVGNVDVDWFGHHIVIEVFSDPLVEGATCHVSYFELGLIDRLENGGWFEDPSNSSITYRQTGPISIGDIDRSDEG… |
| A0A3S5DUR9 | 4-121 | AEEIGSVDTVFKMIGPDHKIVVEAFDDPDVKNVTCYVSRAKTGGIKGGLGLAEDTSDAAISCQQVGPIELSDRIKNGKAQGEVVFKK… |
| A0A812IMI6 | 694-816 | None |
| C1E9Y1 | 20-178 | None |
| A0A5B5U5D7 | 16-121 | None |
| A0A0F6AA80 | 3-100 | None |
| A0A1H0D0K7 | 7-112 | None |
| A0A7S4DEM1 | 97-199 | None |
| R1FAR2 | 3-132 | None |
| A0A1J5S0Q1 | 190-342 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.