DPCstruct | MC5738
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 71 ± 10 aa |
| Standard deviation of domain lengths | 9.74 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 88.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 45.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A377AIT9 | 28-105 | DPNFATTMTNALAGKQPKDATLTALAGLATAADRFPYFTGNDVASLATLTKVGRDILAKSTVAAVIEYLGLQETVNKA |
| A0A2X1NED4 | 10-82 | DPNFATTMTNALAGKQPLDATLTALASLATGANKLPYFTGKDTVAQTDLTSVGRDILAKTSILAVIQYLGLRE |
| A0A1Y6D585 | 372-441 | None |
| A0A2S5LDS8 | 153-223 | None |
| A0A3F2TYX8 | 83-154 | None |
| A0A827FX06 | 386-447 | None |
| A0A7I7D4V0 | 125-183 | None |
| A0A5C7PZJ3 | 103-188 | None |
| A0A485BA20 | 12-74 | None |
| A0A828B571 | 2-68 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.