DPCstruct | MC57377
Metacluster Properties and Pfam Annotations
| Number of structural domains | 87 |
|---|---|
| Mean domain length (aa) | 139 ± 23 aa |
| Standard deviation of domain lengths | 22.75 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 76.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 29.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A815HIL0 | 8-138 | STSHKNFLPCKDGYDCQLQYDNATEHNASYSHPCRWSELCRDMNRDSEHTRHFTHAPHQAILCKYGSENCTKLTNPEHRSLYRHEGL… |
| A0A815NSQ8 | 129-246 | QYPTPCPYTPFHCSLYDDLTEHRNSRGLSNAVHQHCLNFAHVCRAGRNCTDTTQLHWSRSFHIARNLCPYGEKCLRLTDEEHLNSFT… |
| A0A814Q5T4 | 257-384 | None |
| A0A815L856 | 9-174 | None |
| A0A821HF11 | 147-289 | None |
| A0A433Q935 | 23-127 | None |
| A0A817NE78 | 1-91 | None |
| A0A820UE01 | 734-858 | None |
| A0A813YKN2 | 178-310 | None |
| A0A813YCN0 | 9-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.