DPCstruct | MC5737
Metacluster Properties and Pfam Annotations
| Number of structural domains | 114 |
|---|---|
| Mean domain length (aa) | 84 ± 13 aa |
| Standard deviation of domain lengths | 13.00 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 87.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 42.52 |
| Pfam Score | 89.54 |
| Assigned Pfam label(s) | CL0139- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4W2HU35 | 165-258 | NRLFYLALPPTVYEAVTKNIHETCMSQTGWNRIIVEKPFGRDLQSSNQLSNHIASLFHEDQIYRIDHYLGKEMVQNLMVLRFANRIF… |
| A0A2X1NA16 | 1-69 | MPPSTFGAICKGLGEAKLNAKPARVVMEKPLGTSLATSQEINDQVGEYFEECQVYRIDHYLGKETVLNL |
| A0A287TQ77 | 37-138 | None |
| A0A445CQC5 | 14-104 | None |
| A0A3D2EXY0 | 128-211 | None |
| G0QIE2 | 104-179 | None |
| A0A6N9YDK5 | 2-74 | None |
| A0A814Q0V0 | 289-383 | None |
| A0A0G2AIE0 | 121-201 | None |
| A0A821QJT8 | 145-223 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.