DPCstruct | MC57361
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 121 ± 20 aa |
| Standard deviation of domain lengths | 20.27 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 28.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V8QV73 | 1-118 | MELFSLKMWLAVMTLCTLWARPSSAFPAGGAKPMFTEIAAQAGVRHVHQKPVFDQRLAKVMPWITSLNAGVAVGDYNGDGRPDLYVV… |
| A0A2V9QWX2 | 83-188 | PSPIFVEISSQVLGGNSSYTEQMLQGTDYWRTVLDAASGIDVYGNNGLAVGDIDDDGFDELYICQPAGLPNRLYRNRGDGSFEDVTE… |
| A0A7C5G8E3 | 1-144 | None |
| A0A2V8U0V7 | 1-147 | None |
| A0A2V9QR77 | 1-103 | None |
| A0A6C0RAR1 | 2-117 | None |
| A0A2H0QP15 | 9-116 | None |
| A0A2V7TM08 | 5-107 | None |
| A0A6L8HM06 | 1-131 | None |
| A0A3D0NAS3 | 23-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.