DPCstruct | MC5736
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 259 ± 24 aa |
| Standard deviation of domain lengths | 23.75 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 44.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0182 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J4L1C8 | 28-297 | VSAPLIITSISMLFMVFAGFDYLNNNRFGYGEKYYEAWCAMPALSLAMVGISALTPVLRIVLKPIVSPIYKGLGSHPAMFAGTLLAC… |
| A0A2X1N9U5 | 1-208 | MVGMTALAPVLAHVLGPVIIPVYEMLGANPSMFAGTLLACDMGGFFLAKELAGGDVAAWLYSGLILGSMMGPTIVFSIPVALGIIEP… |
| A0A0A2WJU7 | 404-687 | None |
| A0A625T9U5 | 344-620 | None |
| A0A6H2JWM8 | 1-254 | None |
| A0A7H4SI70 | 2-235 | None |
| A0A3S4K7P3 | 1-292 | None |
| A0A376RF69 | 1-230 | None |
| A0A2Y0PCK6 | 1-267 | None |
| E6MHI6 | 66-316 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.