DPCstruct | MC57359
Metacluster Properties and Pfam Annotations
| Number of structural domains | 364 |
|---|---|
| Mean domain length (aa) | 145 ± 29 aa |
| Standard deviation of domain lengths | 29.15 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 84.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 19.28 |
| Pfam Score | 81.14 |
| Assigned Pfam label(s) | CL0179- CL0021- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V8QL91 | 8-141 | SKYVPKRSTDWLKVKTIMRAEVVVGGYTQPRGRRSYFGSLVCGLYRDDGLRYVAHVGGGFNERKLASIYKLMQPLKTGKSSFVDVPK… |
| A0A6F8NUA8 | 2-99 | TIAGFALDGTKWDGIYVGRRKGDDLVYAGKVDHGFDKVSAADLQRRLRPLIRKTQPYTKRIGHKGIWVEPKLLAEIEYRAKSAEGKV… |
| K2DB73 | 1-137 | None |
| A0A2H6KHK0 | 845-1000 | None |
| A0A497I9D4 | 240-373 | None |
| A0A554UJ28 | 54-183 | None |
| A0A0D2FPM1 | 2-145 | None |
| A0A257MDK1 | 92-233 | None |
| A0A2W1BSD6 | 116-279 | None |
| A0A4Q0PH21 | 6-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.