DPCstruct | MC57356
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1348 |
|---|---|
| Mean domain length (aa) | 317 ± 90 aa |
| Standard deviation of domain lengths | 90.22 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 84.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 15.92 |
| Pfam Score | 63.65 |
| Assigned Pfam label(s) | PF13675- CL0681- PF04423- CL0202- PF12777 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V1REU4 | 287-501 | QVDPQVAEREAMLRQAERGVEVARSEAREAREAIAEAHAEVGIRRAAIEEAQAMLEAARQERAGAESDLNSARSMVADAESMQEAAR… |
| A0A1Q8QIJ3 | 31-353 | ISQAAVNEGKARLCADEAIAARSQSEGLKIQAERSFDRMKHAAVQLEQMAETLANASQELSHQIEESAQGANMQKSRASESFDAITQ… |
| A0A1Y5TXU1 | 15-280 | None |
| A0A520QMY8 | 457-763 | None |
| A0A7K0BUW4 | 528-896 | None |
| A0A7Y4ZF50 | 23-230 | None |
| A0A1M6PW35 | 113-283 | None |
| A0A356IYU8 | 437-779 | None |
| A0A369KVH0 | 109-364 | None |
| A0A369KM15 | 184-540 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.